![]() |
ehmmsearch |
% ehmmsearch Artemia.fa ../ehmmcalibrate-ex-keep/globin.hmm -auto *->vlstaeeklvkaswgkkvnvaeeggeellrrlfvsppttktffsh<- +ls e+ ++++ wgk+ ++ +e+g + + lf +p+ +f + S13421 303 GLSGLEKNAILSTWGKVRGNLQEVGKATFGKLFTAHPEYQQMFRF 347 * S13421 - - score obs exp (one = represents 1 sequences) ----- --- --- 12 1 0|= % Statistical details of theoretical EVD fit: mu = -7.9790 lambda = 0.6465 chi-sq statistic = 0.0000 P(chi-square) = 0 tophits_s report: Total hits: 1 Satisfying E cutoff: 1 Total memory: 19K tophits_s report: Total hits: 1 Satisfying E cutoff: 1 Total memory: 19K |
Go to the input files for this example
Go to the output files for this example
Standard (Mandatory) qualifiers: [-seqall] seqall Sequence database USA [-hmmfile] infile HMM file [-outfile] outfile Output file name Additional (Optional) qualifiers: (none) Advanced (Unprompted) qualifiers: -nalign integer Number of alignments -evalue float E-value cutoff -hitcut float Hit score cutoff -dbsize integer Calc E-value for DB size n -cpu integer Number of CPUs -dome float E-value domain cutoff -domt float Hit score domain cutoff -forward boolean Use forward algorithm -nulltwo boolean Turn off second null model -pvm boolean Use parallel virtual machine -xnu boolean Use XNU filtering Associated qualifiers: "-seqall" associated qualifiers -sbegin1 integer Start of each sequence to be used -send1 integer End of each sequence to be used -sreverse1 boolean Reverse (if DNA) -sask1 boolean Ask for begin/end/reverse -snucleotide1 boolean Sequence is nucleotide -sprotein1 boolean Sequence is protein -slower1 boolean Make lower case -supper1 boolean Make upper case -sformat1 string Input sequence format -sdbname1 string Database name -sid1 string Entryname -ufo1 string UFO features -fformat1 string Features format -fopenfile1 string Features file name "-outfile" associated qualifiers -odirectory3 string Output directory General qualifiers: -auto boolean Turn off prompts -stdout boolean Write standard output -filter boolean Read standard input, write standard output -options boolean Prompt for standard and additional values -debug boolean Write debug output to program.dbg -verbose boolean Report some/full command line options -help boolean Report command line options. More information on associated and general qualifiers can be found with -help -verbose -warning boolean Report warnings -error boolean Report errors -fatal boolean Report fatal errors -die boolean Report deaths |
Standard (Mandatory) qualifiers | Allowed values | Default | |
---|---|---|---|
[-seqall] (Parameter 1) |
Sequence database USA | Readable sequence(s) | Required |
[-hmmfile] (Parameter 2) |
HMM file | Input file | Required |
[-outfile] (Parameter 3) |
Output file name | Output file | <sequence>.ehmmsearch |
Additional (Optional) qualifiers | Allowed values | Default | |
(none) | |||
Advanced (Unprompted) qualifiers | Allowed values | Default | |
-nalign | Number of alignments | Any integer value | 100 |
-evalue | E-value cutoff | Any numeric value | 10. |
-hitcut | Hit score cutoff | Any numeric value | -1000000. |
-dbsize | Calc E-value for DB size n | Any integer value | 59021 |
-cpu | Number of CPUs | Any integer value | 0 |
-dome | E-value domain cutoff | Any numeric value | 1000000. |
-domt | Hit score domain cutoff | Any numeric value | -1000000. |
-forward | Use forward algorithm | Boolean value Yes/No | No |
-nulltwo | Turn off second null model | Boolean value Yes/No | No |
-pvm | Use parallel virtual machine | Boolean value Yes/No | No |
-xnu | Use XNU filtering | Boolean value Yes/No | No |
>S13421 S13421 GLOBIN - BRINE SHRIMP DKATIKRTWATVTDLPSFGRNVFLSVFAAK PEYKNLFVEFRNIPASELASSERLLYHGGR VLSSIDEAIAGIDTPDRAVKTLLALGERHI SRGTVRRHFEAFSYAFIDELKQRGVESADL AAWRRGWDNIVNVLEAGLLRRQIDLEVTGL SCVDVANIQESWSKVSGDLKTTGSVVFQRM INGHPEYQQLFRQFRDVDLDKLGESNSFVA HVFRVVAAFDGIIHELDNNQFIVSTLKKLG EQHIARGTDISHFQNFRVTLLEYLKENGMN GAQKASWNKAFDAFEKYISMGLSSLKRVDP ITGLSGLEKNAILSTWGKVRGNLQEVGKAT FGKLFTAHPEYQQMFRFSQGMPLASLVESP KFAAHTQRVVSALDQTLLALNRPSDFVYMI KELGLDHINRGTDRSHFENYQVVFIEYLKE TLGDSLDEFTVKSFNHVFEVIISFLNEGLR QADIVDPVTHLTGRQKEMIKASWSKARTDL RSLGQELFMRMFKAHPEYQTLFVNKGFADV PLVSLREDERFISHMANVLGGFDTLLQNLD ESSYFIYSLRNLGDAHIQRKAGTQHFRSFE AILIPILQESQGLDAASVEAWKKFFDVSIG VIAQGLKVATSEEADPVTGLYGKEIVALRQ AFAAVTPRNVEIGKRVFAKLFAAHPEYKNL FKKFEQYSVEELPSTDAFHYHISLVMNRFS SIGKVIDDNVSFVYLLKKLGREHIKRGLSR KQFDQFVELYIAEISSELSDTGRNGLEKVL TFATGVIEQGLFQLGQVDSNTLTALEKQSI QDIWSNLRSTGLQDLAVKIFTRLFSAHPEY KLLFTGRFGNVDNINENAPFKAHLHRVLSA FDIVISTLDDSEHLIRQLKDLGLFHTRLGM TRSHFDNFATAFLSVAQDIAPNQLTVLGRE SLNKGFKLMHGVIEEGLLQLERINPITGLS AREVAVVKQTWNLVKPDLMGVGMRIFKSLF EAFPAYQAVFPKFSDVPLDKLEDTPAVGKH SISVTTKLDELIQTLDEPANLALLARQLGE DHIVLRVNKPMFKSFGKVLVRLLENDLGQR FSSFASRSWHKAYDVIVEYIEEGLQQSYKQ DPVTGITDAEKALVQESWDLLKPDLLGLGR KIFTKVFTKHPDYQILFTRTGFGDTPLTKL DDNPAFGTHIIKVMRAFDHVIQILGKPKTL MAYLRSVGADHIATNVERRHFQAFSNALIP VMQHDLKAQLRPDAVAAWRKGLDRIIGIID QGLIGLKEVNPQNAFSAYDIQAVQRTWALA KPDLMGKGAMVFKQLFTDHGYQPLFSNLAQ YEITGLEGSPELNTHARNVMAQLDTLVGSL QNSIELGQSLAQLGKDHVPRKVNRVHFKDF AEHFIPLMKADLGDEFTPLAESAWKRAFDV MIATIEQGQEGSSHALSSFLTNPVA |
HMMER2.0 NAME globins50 LENG 146 ALPH Amino RF no CS no MAP yes COM ehmmbuild ../../data/hmm/globins50.msf globin.hmm -auto COM ehmmcalibrate globin.hmm -seed 1079460101 -auto NSEQ 50 DATE Fri Jul 15 12:00:00 2005 CKSUM 5854 XT -8455 -4 0 * -8455 -4 0 * NULT -4 -8455 NULE 595 -1558 85 338 -294 453 -1158 197 249 902 -1085 -142 -21 -313 45 531 201 384 -1998 -644 EVD -7.978981 0.646464 HMM A C D E F G H I K L M N P Q R S T V W Y m->m m->i m->d i->m i->i d->m d->d b->m m->e -93 * -4000 1 -1967 -2271 -4498 -4217 -3055 1639 -3307 -2518 -3920 -2945 2068 -3352 193 -3569 -3796 257 -2222 2801 -3514 -3205 1 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -9 -9065 -10107 -894 -1115 -701 -1378 -1093 -8180 2 -1670 -1776 -76 -2279 1025 -3037 3194 232 -52 1914 -955 -2245 -3102 -1004 -2223 -2065 -1610 -1207 -2178 -1775 2 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -9 -9065 -10107 -894 -1115 -701 -1378 -8273 -8175 3 -1713 -1550 -3992 -3365 801 -3249 -2111 -1027 -2974 762 -736 -2876 -3301 -2606 -2796 1725 1747 269 3309 -1618 3 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -9 -9065 -10107 -894 -1115 -701 -1378 -8273 -8170 4 1140 -2941 1606 792 -3253 -2463 -1127 -278 -63 -2954 -2034 -1102 -473 -671 -1220 572 1661 -2558 -3131 -2454 4 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -9 -9065 -10107 -894 -1115 -701 -1378 -8273 -8165 5 1794 -2944 -65 -235 -3261 829 -1114 -284 1649 -2958 -2034 -134 -1104 -656 -1204 60 -589 -2564 -3130 -2449 5 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -9 -9065 -10107 -894 -1115 -701 -1378 -8273 -8160 6 -1748 -3220 1958 2253 -3519 172 -1355 -3271 -993 -829 -2323 -1243 -2761 1731 -1518 -1165 -1696 -335 -3410 -2713 6 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -9 -9065 -10107 -894 -1115 -701 -1378 -8273 -8155 7 -173 -2945 -205 2098 -3264 -2452 -1111 -302 1817 -2960 -2035 433 -2545 -652 -261 -62 -1417 -2566 2430 -2449 7 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -9 -9065 -10107 -894 -1115 -701 -1378 -8273 -8150 8 933 -2910 -1344 -795 -3214 -1181 -1120 -2952 2227 -837 -2004 -157 -2553 1184 -129 241 381 -316 -3104 -2432 8 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -9 -9065 -10107 -894 -1115 -701 -1378 -8273 -8145 9 1054 1483 -2717 -2142 -1752 -2967 -1753 -661 -506 965 533 1919 -3033 494 -2159 300 -763 120 -2182 -1788 9 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -9 -9065 -10107 -894 -1115 -701 -1378 -8273 -8140 10 475 -184 -3984 -927 -1458 -3217 -2087 964 -2953 185 -705 -2852 14 -2583 -2766 -2300 -535 2595 1896 -1619 10 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -9 -9065 -10107 -894 -1115 -701 -1378 -8273 -8134 11 -171 -2034 -2133 -1572 -2075 -2788 -1524 1191 1414 546 -1206 859 -2865 894 -1789 -14 -603 1034 -2415 -1962 11 [Part of this file has been deleted for brevity] - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -13 -9069 -10111 -894 -1115 -701 -1378 -8273 -7331 131 1046 -2920 936 659 -3228 -2456 -1116 -1039 363 -2931 1609 -673 -2549 2249 -1206 -311 -848 236 -3111 -2436 131 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -13 -9069 -10111 -894 -1115 -701 -1378 -8273 -7322 132 1525 -2380 -1743 -1189 -2505 -2643 -1343 -80 2077 -2311 -1534 -729 -2731 501 -1500 -603 -889 1459 -2705 -2176 132 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -13 -9069 -10111 -894 -1115 -701 -1378 -8273 -7313 133 738 -1513 -3848 -3222 -198 361 -2054 325 428 1007 -714 -2784 -3243 -2505 -2708 324 -1602 1238 -1968 1351 133 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -13 -9069 -10111 -894 -1115 -701 -1378 -8273 -7304 134 987 1437 598 -22 375 -425 -1546 -562 -1482 -1887 629 128 -2881 -1372 -1826 -262 958 1290 -2386 -1941 134 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -13 -9069 -10111 -894 -1115 -701 -1378 -8273 -7295 135 1231 -2587 -1541 216 -2769 193 -1233 -2428 -54 355 -1715 -467 -2642 -839 -418 386 -1448 1716 -2861 -2275 135 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -13 -9069 -10111 -894 -1115 -701 -1378 -8273 -7285 136 606 -2680 165 660 -2889 865 -1213 -2564 326 1588 -1802 -1227 -2627 -803 -1338 -1459 -507 11 -2936 -2329 136 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -13 -9069 -10111 -894 -1115 -701 -1378 -8273 -7276 137 804 -1523 -4031 -3398 -1482 -3248 -2124 348 -2998 1327 -725 -2891 -3297 -2625 -2804 -1588 1321 1922 1901 -1649 137 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -13 -9069 -10111 -894 -1115 -701 -1378 -8273 -7267 138 1808 -1941 -2321 901 973 -408 -1613 -1543 -1607 -1831 1197 -1869 -2928 -1483 -1921 869 632 -3 -2347 -1916 138 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -13 -9069 -10111 -894 -1115 -701 -1378 -8273 -7257 139 1340 -2950 -394 203 -3271 -2451 1896 -1633 1977 -2966 -2040 1016 -2545 -650 779 -62 -1417 -2572 -3134 -2451 139 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -13 -9069 -10111 -894 -1115 -701 -1378 -8273 -7248 140 1476 -2348 -1739 120 -2460 -2637 -1336 497 345 -2272 1946 710 -2722 -1006 -1512 -916 102 -1854 -2672 2397 140 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -14 -9069 -10111 -894 -1115 -701 -1378 -8273 -7238 141 -1642 -1910 588 -1926 393 -2933 -1677 165 1129 1319 -1086 -1997 -3002 -1605 1807 -1932 -1580 -1356 -2286 1485 141 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -15 -8608 -9650 -894 -1115 -701 -1378 -8273 -7229 142 1542 1691 488 -582 -2626 -279 -862 506 1171 -2375 -136 -872 -2282 -440 468 312 -1114 -1970 -2642 -2022 142 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -16 -8505 -9547 -894 -1115 -701 -1378 -8273 -7219 143 2278 -2091 -2495 -1900 -2272 -2771 3583 522 -1069 -2122 -1438 -1912 -2941 -1387 524 -1886 -1664 -1689 -2531 -2110 143 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -16 -8405 -9447 -894 -1115 -701 -1378 -8273 -7209 144 1313 -1624 -1590 -1030 784 176 -1023 -1263 1746 -28 1368 -1204 -2374 -799 -322 -323 -1039 -1096 -1996 -1532 144 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -16 -8405 -9447 -894 -1115 -701 -1378 -8273 -7200 145 -2395 -2460 -3209 -2720 1335 -3543 -1417 -2096 1716 53 -1668 854 -3574 -2202 -2474 -2599 -2321 -2018 -1148 3600 145 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -17 -8323 -9365 -894 -1115 -701 -1378 -8273 -7190 146 -1328 -1570 -2202 -1667 1530 183 3522 -1184 -1501 -1451 -788 -1688 -2680 -1341 -1757 347 444 -1057 -1556 1992 146 - * * * * * * * * * * * * * * * * * * * * - * * * * * * * -8273 0 // |
Query HMM: globins50|| [HMM has been calibrated; E-values are empirical estimates] Scores for complete sequences (score includes all domains): Sequence Description Score E-value N -------- ----------- ----- ------- --- S13421 GLOBIN - BRINE SHRIMP 12.7 0.089 1 Parsed for domains: Sequence Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- S13421 1/1 303 347 .. 1 45 [. 12.7 0.089 Alignments of top-scoring domains: S13421: domain 1 of 1, from 303 to 347: score 12.7, E = 0.089 Histogram of all scores: Total sequences searched: 1 Whole sequence top hits: Domain top hits: |
Program name | Description |
---|---|
ealistat | Statistics for multiple alignment files |
ehmmalign | Align sequences with an HMM |
ehmmbuild | Build HMM |
ehmmcalibrate | Calibrate a hidden Markov model |
ehmmconvert | Convert between HMM formats |
ehmmemit | Extract HMM sequences |
ehmmfetch | Extract HMM from a database |
ehmmindex | Index an HMM database |
ehmmpfam | Align single sequence with an HMM |
Although we take every care to ensure that the results of the EMBOSS version are identical to those from the original package, we recommend that you check your inputs give the same results in both versions before publication.
Please report all bugs in the EMBOSS version to the EMBOSS bug team, not to the original author.