![]() |
LIBGEN documentation |
# Gribskov Protein Profile # Columns are amino acids A->Z # Last column is indel penalty # Rows are alignment positions 1->n Gribskov Name ./54894.disc Matrix pprofile Length 94 Max_score 1390.50 Threshold 75 Gap_open 3.00 Gap_extend 0.30 Consensus MMFHKIAIQKEHTDNVSIIFADIEGFTALAAACHADELPDALAAHFAMFDKLAAENHCLEIKILGDCFMCASGLPEARADHAFAAVELAMDLIEAFLHVHDMGTNALDDSXREFEEQRAEGECEXTPPTAHMDPEVXSRLWNGLNMRVGIHSGLCDICGDLELRKKGFDVWGNDPNLAAHMEAGAKAGQIHITHAALMSLNAEDGKDIDVEAGCGDERALAGLKEDPIEMFLILTVPSRNFAALRLDREXFDGVEAIKRGTVIDHIPAQIGFKLLSLFKLTETDQRITIGLNLPSGGEMGRKDLIKIENTFLSEDQVDQLALYAPQATVNRIDNYEVVGKSRPSLP 6.00 0.00 2.00 6.00 5.00 -6.00 15.00 -2.00 -3.00 0.00 -1.00 -5.00 -3.00 4.00 0.00 3.00 2.00 -3.00 6.00 4.00 0.00 2.00 -10.00 0.00 -6.00 0.00 4.55 4.55 2.00 0.00 2.00 -2.00 -2.00 2.00 2.00 -3.00 11.00 0.00 -2.00 8.00 6.00 -3.00 0.00 1.00 -2.00 -3.00 -1.00 2.00 0.00 15.00 -8.00 0.00 -1.00 0.00 4.55 4.55 3.00 0.00 -6.00 10.00 15.00 -6.00 5.00 4.00 -2.00 0.00 3.00 -3.00 -2.00 5.00 0.00 1.00 6.00 0.00 2.00 2.00 0.00 -2.00 -11.00 0.00 -5.00 0.00 4.55 4.55 15.00 0.00 3.00 3.00 3.00 -5.00 6.00 -1.00 0.00 0.00 0.00 -1.00 0.00 2.00 0.00 5.00 2.00 -3.00 4.00 4.00 0.00 2.00 -8.00 0.00 -3.00 0.00 4.55 4.55 0.00 0.00 2.00 -2.00 -2.00 6.00 -3.00 -3.00 15.00 0.00 -2.00 8.00 6.00 -3.00 0.00 -2.00 -3.00 -3.00 -1.00 2.00 0.00 11.00 -5.00 0.00 1.00 0.00 4.55 4.55 0.00 0.00 -6.00 3.00 3.00 -6.00 -1.00 1.00 -2.00 0.00 15.00 -3.00 2.00 4.00 0.00 1.00 4.00 8.00 2.00 2.00 0.00 -2.00 1.00 0.00 -6.00 0.00 4.55 4.55 -3.00 0.00 -3.00 0.00 0.00 -5.00 -3.00 5.00 -3.00 0.00 8.00 -4.00 2.00 1.00 0.00 3.00 4.00 15.00 1.00 -1.00 0.00 -3.00 13.00 0.00 -6.00 0.00 4.55 4.55 6.00 0.00 2.00 6.00 5.00 -6.00 15.00 -2.00 -3.00 0.00 -1.00 -5.00 -3.00 4.00 0.00 3.00 2.00 -3.00 6.00 4.00 0.00 2.00 -10.00 0.00 -6.00 0.00 4.55 4.55 4.00 0.00 2.00 2.00 2.00 -3.00 4.00 -1.00 2.00 0.00 2.00 -1.00 0.00 2.00 0.00 3.00 -1.00 -1.00 3.00 15.00 0.00 2.00 -6.00 0.00 -3.00 0.00 4.55 4.55 2.00 0.00 2.00 -2.00 -2.00 2.00 2.00 -3.00 11.00 0.00 -2.00 8.00 6.00 -3.00 0.00 1.00 -2.00 -3.00 -1.00 2.00 0.00 15.00 -8.00 0.00 -1.00 0.00 4.55 4.55 0.00 0.00 2.00 -2.00 -2.00 6.00 -3.00 -3.00 15.00 0.00 -2.00 8.00 6.00 -3.00 0.00 -2.00 -3.00 -3.00 -1.00 2.00 0.00 11.00 -5.00 0.00 1.00 0.00 4.55 4.55 3.00 0.00 -5.00 15.00 10.00 -10.00 6.00 4.00 -2.00 0.00 3.00 -5.00 -4.00 6.00 0.00 1.00 6.00 0.00 2.00 2.00 0.00 -2.00 -11.00 0.00 -5.00 0.00 4.55 4.55 -1.00 0.00 -1.00 4.00 4.00 -1.00 -2.00 15.00 -3.00 0.00 1.00 -2.00 -3.00 5.00 0.00 2.00 6.00 5.00 -2.00 -1.00 0.00 -3.00 -1.00 0.00 3.00 0.00 4.55 4.55 0.00 0.00 2.00 -2.00 -2.00 6.00 -3.00 -3.00 15.00 0.00 -2.00 8.00 6.00 -3.00 0.00 -2.00 -3.00 -3.00 -1.00 2.00 0.00 11.00 -5.00 0.00 1.00 0.00 4.55 4.55 5.00 0.00 1.00 1.00 1.00 -6.00 3.00 2.00 -2.00 0.00 1.00 -3.00 -2.00 0.00 0.00 15.00 3.00 3.00 4.00 3.00 0.00 1.00 -8.00 0.00 -8.00 0.00 4.55 4.55 15.00 0.00 3.00 3.00 3.00 -5.00 6.00 -1.00 0.00 0.00 0.00 -1.00 0.00 2.00 0.00 5.00 2.00 -3.00 4.00 4.00 0.00 2.00 -8.00 0.00 -3.00 0.00 4.55 4.55 2.00 0.00 -6.00 6.00 6.00 -8.00 2.00 6.00 -3.00 0.00 4.00 -1.00 0.00 4.00 0.00 3.00 15.00 4.00 -1.00 -1.00 0.00 -2.00 -5.00 0.00 -6.00 0.00 4.55 4.55 0.00 0.00 2.00 -2.00 -2.00 6.00 -3.00 -3.00 15.00 0.00 -2.00 8.00 6.00 -3.00 0.00 -2.00 -3.00 -3.00 -1.00 2.00 0.00 11.00 -5.00 0.00 1.00 0.00 4.55 4.55 6.00 0.00 2.00 6.00 5.00 -6.00 15.00 -2.00 -3.00 0.00 -1.00 -5.00 -3.00 4.00 0.00 3.00 2.00 -3.00 6.00 4.00 0.00 2.00 -10.00 0.00 -6.00 0.00 4.55 4.55 -5.00 0.00 -1.00 -10.00 -6.00 15.00 -6.00 -1.00 6.00 0.00 -6.00 12.00 5.00 -5.00 0.00 -6.00 -8.00 -5.00 -3.00 -3.00 0.00 2.00 12.00 0.00 13.00 0.00 4.55 4.55 0.00 0.00 -6.00 3.00 3.00 -6.00 -1.00 1.00 -2.00 0.00 15.00 -3.00 2.00 4.00 0.00 1.00 4.00 8.00 2.00 2.00 0.00 -2.00 1.00 0.00 -6.00 0.00 4.55 4.55 -1.00 0.00 -8.00 -5.00 -3.00 12.00 -5.00 -2.00 8.00 0.00 -3.00 15.00 12.00 -4.00 0.00 -3.00 -1.00 -4.00 -4.00 -1.00 0.00 8.00 5.00 0.00 3.00 0.00 4.55 4.55 -1.00 0.00 -8.00 -5.00 -3.00 12.00 -5.00 -2.00 8.00 0.00 -3.00 15.00 12.00 -4.00 0.00 -3.00 -1.00 -4.00 -4.00 -1.00 0.00 8.00 5.00 0.00 3.00 0.00 4.55 4.55 4.00 0.00 6.00 2.00 2.00 -3.00 6.00 -2.00 -1.00 0.00 2.00 -4.00 -3.00 3.00 0.00 4.00 -1.00 1.00 15.00 3.00 0.00 -1.00 3.00 0.00 -4.00 0.00 4.55 4.55 -1.00 0.00 -8.00 -5.00 -3.00 12.00 -5.00 -2.00 8.00 0.00 -3.00 15.00 12.00 -4.00 0.00 -3.00 -1.00 -4.00 -4.00 -1.00 0.00 8.00 5.00 0.00 3.00 0.00 4.55 4.55 -5.00 0.00 -1.00 -10.00 -6.00 15.00 -6.00 -1.00 6.00 0.00 -6.00 12.00 5.00 -5.00 0.00 -6.00 -8.00 -5.00 -3.00 -3.00 0.00 2.00 12.00 0.00 13.00 0.00 4.55 4.55 0.00 0.00 -6.00 3.00 3.00 -6.00 -1.00 1.00 -2.00 0.00 15.00 -3.00 2.00 4.00 0.00 1.00 4.00 8.00 2.00 2.00 0.00 -2.00 1.00 0.00 -6.00 0.00 4.55 4.55 -1.00 0.00 -8.00 -5.00 -3.00 12.00 -5.00 -2.00 8.00 0.00 -3.00 15.00 12.00 -4.00 0.00 -3.00 -1.00 -4.00 -4.00 -1.00 0.00 8.00 5.00 0.00 3.00 0.00 4.55 4.55 4.00 0.00 2.00 2.00 2.00 -3.00 4.00 -1.00 2.00 0.00 2.00 -1.00 0.00 2.00 0.00 3.00 -1.00 -1.00 3.00 15.00 0.00 2.00 -6.00 0.00 -3.00 0.00 4.55 4.55 3.00 0.00 -6.00 10.00 15.00 -6.00 5.00 4.00 -2.00 0.00 3.00 -3.00 -2.00 5.00 0.00 1.00 6.00 0.00 2.00 2.00 0.00 -2.00 -11.00 0.00 -5.00 0.00 4.55 4.55 4.00 0.00 2.00 2.00 2.00 -3.00 4.00 -1.00 2.00 0.00 2.00 -1.00 0.00 2.00 0.00 3.00 -1.00 -1.00 3.00 15.00 0.00 2.00 -6.00 0.00 -3.00 0.00 4.55 4.55 3.00 0.00 -5.00 15.00 10.00 -10.00 6.00 4.00 -2.00 0.00 3.00 -5.00 -4.00 6.00 0.00 1.00 6.00 0.00 2.00 2.00 0.00 -2.00 -11.00 0.00 -5.00 0.00 4.55 4.55 2.00 0.00 -6.00 6.00 6.00 -8.00 2.00 6.00 -3.00 0.00 4.00 -1.00 0.00 4.00 0.00 3.00 15.00 4.00 -1.00 -1.00 0.00 -2.00 -5.00 0.00 -6.00 0.00 4.55 4.55 -3.00 0.00 -3.00 0.00 0.00 -5.00 -3.00 5.00 -3.00 0.00 8.00 -4.00 2.00 1.00 0.00 3.00 4.00 15.00 1.00 -1.00 0.00 -3.00 13.00 0.00 -6.00 0.00 4.55 4.55 0.00 0.00 2.00 -2.00 -2.00 6.00 -3.00 -3.00 15.00 0.00 -2.00 8.00 6.00 -3.00 0.00 -2.00 -3.00 -3.00 -1.00 2.00 0.00 11.00 -5.00 0.00 1.00 0.00 4.55 4.55 4.00 0.00 2.00 2.00 2.00 -3.00 4.00 -1.00 2.00 0.00 2.00 -1.00 0.00 2.00 0.00 3.00 -1.00 -1.00 3.00 15.00 0.00 2.00 -6.00 0.00 -3.00 0.00 4.55 4.55 0.00 0.00 2.00 -2.00 -2.00 6.00 -3.00 -3.00 15.00 0.00 -2.00 8.00 6.00 -3.00 0.00 -2.00 -3.00 -3.00 -1.00 2.00 0.00 11.00 -5.00 0.00 1.00 0.00 4.55 4.55 [Part of this file has been deleted for brevity] 5.00 0.00 4.00 4.00 3.50 -4.50 10.50 -2.00 -2.00 0.00 0.50 -4.50 -3.00 3.50 0.00 3.50 0.50 -1.00 10.50 3.50 0.00 0.50 -3.50 0.00 -5.00 0.00 4.55 4.55 3.00 0.00 1.00 3.00 2.50 -3.00 7.50 -1.00 -1.50 0.00 -0.50 -2.50 -1.50 2.00 0.00 1.50 1.00 -1.50 3.00 2.00 0.00 1.00 -5.00 0.00 -3.00 0.00 4.55 4.55 3.00 0.00 -6.00 10.00 15.00 -6.00 5.00 4.00 -2.00 0.00 3.00 -3.00 -2.00 5.00 0.00 1.00 6.00 0.00 2.00 2.00 0.00 -2.00 -11.00 0.00 -5.00 0.00 4.55 4.55 0.00 0.00 -6.00 -4.00 -2.00 5.00 -3.00 -3.00 6.00 0.00 2.00 12.00 15.00 -3.00 0.00 -2.00 0.00 2.00 -3.00 0.00 0.00 6.00 -3.00 0.00 -1.00 0.00 4.55 4.55 6.00 0.00 2.00 6.00 5.00 -6.00 15.00 -2.00 -3.00 0.00 -1.00 -5.00 -3.00 4.00 0.00 3.00 2.00 -3.00 6.00 4.00 0.00 2.00 -10.00 0.00 -6.00 0.00 4.55 4.55 -3.00 0.00 -3.00 0.00 0.00 -5.00 -3.00 5.00 -3.00 0.00 8.00 -4.00 2.00 1.00 0.00 3.00 4.00 15.00 1.00 -1.00 0.00 -3.00 13.00 0.00 -6.00 0.00 4.55 4.55 0.00 0.00 -6.00 3.00 3.00 -6.00 -1.00 1.00 -2.00 0.00 15.00 -3.00 2.00 4.00 0.00 1.00 4.00 8.00 2.00 2.00 0.00 -2.00 1.00 0.00 -6.00 0.00 4.55 4.55 3.00 0.00 -5.00 15.00 10.00 -10.00 6.00 4.00 -2.00 0.00 3.00 -5.00 -4.00 6.00 0.00 1.00 6.00 0.00 2.00 2.00 0.00 -2.00 -11.00 0.00 -5.00 0.00 4.55 4.55 -1.00 0.00 -8.00 -5.00 -3.00 12.00 -5.00 -2.00 8.00 0.00 -3.00 15.00 12.00 -4.00 0.00 -3.00 -1.00 -4.00 -4.00 -1.00 0.00 8.00 5.00 0.00 3.00 0.00 4.55 4.55 0.00 0.00 2.00 -2.00 -2.00 6.00 -3.00 -3.00 15.00 0.00 -2.00 8.00 6.00 -3.00 0.00 -2.00 -3.00 -3.00 -1.00 2.00 0.00 11.00 -5.00 0.00 1.00 0.00 4.55 4.55 0.00 0.00 -6.00 3.00 3.00 -6.00 -1.00 1.00 -2.00 0.00 15.00 -3.00 2.00 4.00 0.00 1.00 4.00 8.00 2.00 2.00 0.00 -2.00 1.00 0.00 -6.00 0.00 4.55 4.55 0.00 0.00 2.00 -2.00 -2.00 6.00 -3.00 -3.00 15.00 0.00 -2.00 8.00 6.00 -3.00 0.00 -2.00 -3.00 -3.00 -1.00 2.00 0.00 11.00 -5.00 0.00 1.00 0.00 4.55 4.55 3.00 0.00 -6.00 10.00 15.00 -6.00 5.00 4.00 -2.00 0.00 3.00 -3.00 -2.00 5.00 0.00 1.00 6.00 0.00 2.00 2.00 0.00 -2.00 -11.00 0.00 -5.00 0.00 4.55 4.55 2.00 0.00 -3.00 6.00 5.00 -5.00 4.00 5.00 -3.00 0.00 4.00 -4.00 -3.00 15.00 0.00 0.00 4.00 1.00 3.00 2.00 0.00 -3.00 -3.00 0.00 -1.00 0.00 4.55 4.55 4.00 0.00 2.00 2.00 2.00 -3.00 4.00 -1.00 2.00 0.00 2.00 -1.00 0.00 2.00 0.00 3.00 -1.00 -1.00 3.00 15.00 0.00 2.00 -6.00 0.00 -3.00 0.00 4.55 4.55 -5.00 0.00 -1.00 -10.00 -6.00 15.00 -6.00 -1.00 6.00 0.00 -6.00 12.00 5.00 -5.00 0.00 -6.00 -8.00 -5.00 -3.00 -3.00 0.00 2.00 12.00 0.00 13.00 0.00 4.55 4.55 -1.00 0.00 -8.00 -5.00 -3.00 12.00 -5.00 -2.00 8.00 0.00 -3.00 15.00 12.00 -4.00 0.00 -3.00 -1.00 -4.00 -4.00 -1.00 0.00 8.00 5.00 0.00 3.00 0.00 4.55 4.55 4.00 0.00 6.00 2.00 2.00 -3.00 6.00 -2.00 -1.00 0.00 2.00 -4.00 -3.00 3.00 0.00 4.00 -1.00 1.00 15.00 3.00 0.00 -1.00 3.00 0.00 -4.00 0.00 4.55 4.55 3.00 0.00 -6.00 10.00 15.00 -6.00 5.00 4.00 -2.00 0.00 3.00 -3.00 -2.00 5.00 0.00 1.00 6.00 0.00 2.00 2.00 0.00 -2.00 -11.00 0.00 -5.00 0.00 4.55 4.55 3.00 0.00 -5.00 15.00 10.00 -10.00 6.00 4.00 -2.00 0.00 3.00 -5.00 -4.00 6.00 0.00 1.00 6.00 0.00 2.00 2.00 0.00 -2.00 -11.00 0.00 -5.00 0.00 4.55 4.55 2.00 0.00 -6.00 6.00 6.00 -8.00 2.00 6.00 -3.00 0.00 4.00 -1.00 0.00 4.00 0.00 3.00 15.00 4.00 -1.00 -1.00 0.00 -2.00 -5.00 0.00 -6.00 0.00 4.55 4.55 2.00 0.00 2.00 -2.00 -2.00 2.00 2.00 -3.00 11.00 0.00 -2.00 8.00 6.00 -3.00 0.00 1.00 -2.00 -3.00 -1.00 2.00 0.00 15.00 -8.00 0.00 -1.00 0.00 4.55 4.55 3.00 0.00 -5.00 15.00 10.00 -10.00 6.00 4.00 -2.00 0.00 3.00 -5.00 -4.00 6.00 0.00 1.00 6.00 0.00 2.00 2.00 0.00 -2.00 -11.00 0.00 -5.00 0.00 4.55 4.55 2.00 0.00 -6.00 6.00 6.00 -8.00 2.00 6.00 -3.00 0.00 4.00 -1.00 0.00 4.00 0.00 3.00 15.00 4.00 -1.00 -1.00 0.00 -2.00 -5.00 0.00 -6.00 0.00 4.55 4.55 -1.00 0.00 -8.00 -5.00 -3.00 12.00 -5.00 -2.00 8.00 0.00 -3.00 15.00 12.00 -4.00 0.00 -3.00 -1.00 -4.00 -4.00 -1.00 0.00 8.00 5.00 0.00 3.00 0.00 4.55 4.55 15.00 0.00 3.00 3.00 3.00 -5.00 6.00 -1.00 0.00 0.00 0.00 -1.00 0.00 2.00 0.00 5.00 2.00 -3.00 4.00 4.00 0.00 2.00 -8.00 0.00 -3.00 0.00 4.55 4.55 -1.00 0.00 -8.00 -5.00 -3.00 12.00 -5.00 -2.00 8.00 0.00 -3.00 15.00 12.00 -4.00 0.00 -3.00 -1.00 -4.00 -4.00 -1.00 0.00 8.00 5.00 0.00 3.00 0.00 4.55 4.55 -3.00 0.00 10.00 -5.00 -5.00 13.00 -6.00 3.00 1.00 0.00 -6.00 3.00 -1.00 -1.00 0.00 -8.00 -6.00 -6.00 -4.00 -3.00 0.00 -1.00 11.00 0.00 15.00 0.00 4.55 4.55 15.00 0.00 3.00 3.00 3.00 -5.00 6.00 -1.00 0.00 0.00 0.00 -1.00 0.00 2.00 0.00 5.00 2.00 -3.00 4.00 4.00 0.00 2.00 -8.00 0.00 -3.00 0.00 4.55 4.55 5.00 0.00 1.00 1.00 1.00 -6.00 3.00 2.00 -2.00 0.00 1.00 -3.00 -2.00 0.00 0.00 15.00 3.00 3.00 4.00 3.00 0.00 1.00 -8.00 0.00 -8.00 0.00 4.55 4.55 2.00 0.00 -6.00 6.00 6.00 -8.00 2.00 6.00 -3.00 0.00 4.00 -1.00 0.00 4.00 0.00 3.00 15.00 4.00 -1.00 -1.00 0.00 -2.00 -5.00 0.00 -6.00 0.00 4.55 4.55 15.00 0.00 3.00 3.00 3.00 -5.00 6.00 -1.00 0.00 0.00 0.00 -1.00 0.00 2.00 0.00 5.00 2.00 -3.00 4.00 4.00 0.00 2.00 -8.00 0.00 -3.00 0.00 4.55 4.55 4.00 0.00 2.00 2.00 2.00 -3.00 4.00 -1.00 2.00 0.00 2.00 -1.00 0.00 2.00 0.00 3.00 -1.00 -1.00 3.00 15.00 0.00 2.00 -6.00 0.00 -3.00 0.00 4.55 4.55 2.00 0.00 2.00 -2.00 -2.00 2.00 2.00 -3.00 11.00 0.00 -2.00 8.00 6.00 -3.00 0.00 1.00 -2.00 -3.00 -1.00 2.00 0.00 15.00 -8.00 0.00 -1.00 0.00 4.55 4.55 2.00 0.00 -3.00 6.00 5.00 -5.00 4.00 5.00 -3.00 0.00 4.00 -4.00 -3.00 15.00 0.00 0.00 4.00 1.00 3.00 2.00 0.00 -3.00 -3.00 0.00 -1.00 0.00 4.55 4.55 -3.00 0.00 -3.00 0.00 0.00 -5.00 -3.00 5.00 -3.00 0.00 8.00 -4.00 2.00 1.00 0.00 3.00 4.00 15.00 1.00 -1.00 0.00 -3.00 13.00 0.00 -6.00 0.00 4.55 4.55 0.00 0.00 2.00 -2.00 -2.00 6.00 -3.00 -3.00 15.00 0.00 -2.00 8.00 6.00 -3.00 0.00 -2.00 -3.00 -3.00 -1.00 2.00 0.00 11.00 -5.00 0.00 1.00 0.00 4.55 4.55 3.00 0.00 -5.00 15.00 10.00 -10.00 6.00 4.00 -2.00 0.00 3.00 -5.00 -4.00 6.00 0.00 1.00 6.00 0.00 2.00 2.00 0.00 -2.00 -11.00 0.00 -5.00 0.00 4.55 4.55 2.00 0.00 -3.00 6.00 5.00 -5.00 4.00 5.00 -3.00 0.00 4.00 -4.00 -3.00 15.00 0.00 0.00 4.00 1.00 3.00 2.00 0.00 -3.00 -3.00 0.00 -1.00 0.00 4.55 4.55 -3.00 0.00 10.00 -5.00 -5.00 13.00 -6.00 3.00 1.00 0.00 -6.00 3.00 -1.00 -1.00 0.00 -8.00 -6.00 -6.00 -4.00 -3.00 0.00 -1.00 11.00 0.00 15.00 0.00 4.55 4.55 3.00 0.00 -6.00 10.00 15.00 -6.00 5.00 4.00 -2.00 0.00 3.00 -3.00 -2.00 5.00 0.00 1.00 6.00 0.00 2.00 2.00 0.00 -2.00 -11.00 0.00 -5.00 0.00 4.55 4.55 2.00 0.00 2.00 -2.00 -2.00 2.00 2.00 -3.00 11.00 0.00 -2.00 8.00 6.00 -3.00 0.00 1.00 -2.00 -3.00 -1.00 2.00 0.00 15.00 -8.00 0.00 -1.00 0.00 4.55 4.55 2.00 0.00 2.00 -2.00 -2.00 2.00 2.00 -3.00 11.00 0.00 -2.00 8.00 6.00 -3.00 0.00 1.00 -2.00 -3.00 -1.00 2.00 0.00 15.00 -8.00 0.00 -1.00 0.00 4.55 4.55 6.00 0.00 2.00 6.00 5.00 -6.00 15.00 -2.00 -3.00 0.00 -1.00 -5.00 -3.00 4.00 0.00 3.00 2.00 -3.00 6.00 4.00 0.00 2.00 -10.00 0.00 -6.00 0.00 4.55 4.55 0.00 0.00 -6.00 3.00 3.00 -6.00 -1.00 1.00 -2.00 0.00 15.00 -3.00 2.00 4.00 0.00 1.00 4.00 8.00 2.00 2.00 0.00 -2.00 1.00 0.00 -6.00 0.00 4.55 4.55 4.00 0.00 6.00 2.00 2.00 -3.00 6.00 -2.00 -1.00 0.00 2.00 -4.00 -3.00 3.00 0.00 4.00 -1.00 1.00 15.00 3.00 0.00 -1.00 3.00 0.00 -4.00 0.00 4.55 4.55 -3.00 0.00 -3.00 0.00 0.00 -5.00 -3.00 5.00 -3.00 0.00 8.00 -4.00 2.00 1.00 0.00 3.00 4.00 15.00 1.00 -1.00 0.00 -3.00 13.00 0.00 -6.00 0.00 4.55 4.55 5.00 0.00 1.00 1.00 1.00 -6.00 3.00 2.00 -2.00 0.00 1.00 -3.00 -2.00 0.00 0.00 15.00 3.00 3.00 4.00 3.00 0.00 1.00 -8.00 0.00 -8.00 0.00 4.55 4.55 4.00 0.00 6.00 2.00 2.00 -3.00 6.00 -2.00 -1.00 0.00 2.00 -4.00 -3.00 3.00 0.00 4.00 -1.00 1.00 15.00 3.00 0.00 -1.00 3.00 0.00 -4.00 0.00 4.55 4.55 -1.00 0.00 -8.00 -5.00 -3.00 12.00 -5.00 -2.00 8.00 0.00 -3.00 15.00 12.00 -4.00 0.00 -3.00 -1.00 -4.00 -4.00 -1.00 0.00 8.00 5.00 0.00 3.00 0.00 4.55 4.55 5.00 0.00 1.00 1.00 1.00 -6.00 3.00 2.00 -2.00 0.00 1.00 -3.00 -2.00 0.00 0.00 15.00 3.00 3.00 4.00 3.00 0.00 1.00 -8.00 0.00 -8.00 0.00 4.55 4.55 |
# Gribskov Protein Profile # Columns are amino acids A->Z # Last column is indel penalty # Rows are alignment positions 1->n Gribskov Name ./55074.disc Matrix pprofile Length 252 Max_score 2330.00 Threshold 75 Gap_open 3.00 Gap_extend 0.30 Consensus MMFHKIAIQKEHTDNVSIIFADIEGFTALAAACHADELPDALAAHFAMFDKLAAENHCLEIKILGDCFMCASGLPEARADHAFAAVELAMDLIEAFLHVHDMGTNALDDSXREFEEQRAEGECEXTPPTAHMDPEVXSRLWNGLNMRVGIHSGLCDICGDLELRKKGFDVWGNDPNLAAHMEAGAKAGQIHITHAALMSLNAEDGKDIDVEAGCGDERALAGLKEDPIEMFLILTVPSRNFAALRLDREXFD 0.00 0.00 -3.00 -2.00 -1.00 2.50 -1.50 -1.50 3.00 0.00 1.00 6.00 7.50 -1.50 0.00 -1.00 0.00 1.00 -1.50 0.00 0.00 3.00 -1.50 0.00 -0.50 0.00 4.55 4.55 0.00 0.00 -3.00 -2.00 -1.00 2.50 -1.50 -1.50 3.00 0.00 1.00 6.00 7.50 -1.50 0.00 -1.00 0.00 1.00 -1.50 0.00 0.00 3.00 -1.50 0.00 -0.50 0.00 4.55 4.55 -1.50 0.00 -2.00 -2.00 -0.50 5.00 -1.00 2.00 1.50 0.00 -1.00 4.00 1.00 5.00 0.00 -3.00 -2.00 -2.00 0.00 -0.50 0.00 -0.50 4.50 0.00 6.00 0.00 4.55 4.55 0.50 0.00 -2.00 5.00 4.50 -3.00 1.00 10.00 -3.00 0.00 2.50 -3.00 -3.00 10.00 0.00 1.00 5.00 3.00 0.50 0.50 0.00 -3.00 -2.00 0.00 1.00 0.00 4.55 4.55 1.00 0.00 -4.50 4.50 4.00 -5.50 1.50 3.00 -2.50 0.00 9.50 -3.50 -0.50 9.50 0.00 0.50 4.00 4.50 2.50 2.00 0.00 -2.50 -1.00 0.00 -3.50 0.00 4.55 4.55 -1.50 0.00 -0.50 -1.00 -1.00 0.50 -3.00 1.00 6.00 0.00 3.00 2.00 4.00 -1.00 0.00 0.50 0.50 6.00 0.00 0.50 0.00 4.00 4.00 0.00 -2.50 0.00 4.55 4.55 6.00 0.00 6.50 -1.00 -1.00 4.00 0.00 1.00 0.50 0.00 -3.00 1.00 -0.50 0.50 0.00 -1.50 -2.00 -4.50 0.00 0.50 0.00 0.50 1.50 0.00 6.00 0.00 4.55 4.55 2.50 0.00 1.50 -0.50 -0.50 0.00 0.00 -0.50 6.50 0.00 -0.50 2.50 2.00 -1.50 0.00 6.50 0.00 0.00 1.50 2.50 0.00 6.00 -6.50 0.00 -3.50 0.00 4.55 4.55 1.00 0.00 -3.00 3.00 3.00 -4.00 1.00 3.00 -1.50 0.00 2.00 -0.50 0.00 2.00 0.00 1.50 7.50 2.00 -0.50 -0.50 0.00 -1.00 -2.50 0.00 -3.00 0.00 4.55 4.55 0.00 0.00 -6.00 3.00 3.00 -6.00 -1.00 1.00 -2.00 0.00 15.00 -3.00 2.00 4.00 0.00 1.00 4.00 8.00 2.00 2.00 0.00 -2.00 1.00 0.00 -6.00 0.00 4.55 4.55 1.50 0.00 -3.00 5.00 7.50 -3.00 2.50 2.00 -1.00 0.00 1.50 -1.50 -1.00 2.50 0.00 0.50 3.00 0.00 1.00 1.00 0.00 -1.00 -5.50 0.00 -2.50 0.00 4.55 4.55 2.00 0.00 0.00 2.50 2.50 -3.50 0.50 8.50 -2.50 0.00 1.00 -2.50 -2.50 2.50 0.00 8.50 4.50 4.00 1.00 1.00 0.00 -1.00 -4.50 0.00 -2.50 0.00 4.55 4.55 2.00 0.00 1.00 1.00 1.00 -1.50 2.00 -0.50 1.00 0.00 1.00 -0.50 0.00 1.00 0.00 1.50 -0.50 -0.50 1.50 7.50 0.00 1.00 -3.00 0.00 -1.50 0.00 4.55 4.55 3.00 0.00 -5.00 15.00 10.00 -10.00 6.00 4.00 -2.00 0.00 3.00 -5.00 -4.00 6.00 0.00 1.00 6.00 0.00 2.00 2.00 0.00 -2.00 -11.00 0.00 -5.00 0.00 4.55 4.55 3.50 0.00 -1.00 3.50 3.00 -5.50 3.50 3.50 -2.50 0.00 2.50 -3.50 -2.50 7.50 0.00 7.50 3.50 2.00 3.50 2.50 0.00 -1.00 -5.50 0.00 -4.50 0.00 4.55 4.55 2.00 0.00 2.00 -2.00 -2.00 2.00 2.00 -3.00 11.00 0.00 -2.00 8.00 6.00 -3.00 0.00 1.00 -2.00 -3.00 -1.00 2.00 0.00 15.00 -8.00 0.00 -1.00 0.00 4.55 4.55 4.00 0.00 4.00 2.00 2.00 -3.00 5.00 -1.50 0.50 0.00 2.00 -2.50 -1.50 2.50 0.00 3.50 -1.00 0.00 9.00 9.00 0.00 0.50 -1.50 0.00 -3.50 0.00 4.55 4.55 -0.50 0.00 -3.00 -3.50 -2.50 9.00 -4.00 -2.50 11.50 0.00 -2.50 11.50 9.00 -3.50 0.00 -2.50 -2.00 -3.50 -2.50 0.50 0.00 9.50 0.00 0.00 2.00 0.00 4.55 4.55 -0.50 0.00 -3.00 -3.50 -2.50 9.00 -4.00 -2.50 11.50 0.00 -2.50 11.50 9.00 -3.50 0.00 -2.50 -2.00 -3.50 -2.50 0.50 0.00 9.50 0.00 0.00 2.00 0.00 4.55 4.55 -5.00 0.00 -1.00 -10.00 -6.00 15.00 -6.00 -1.00 6.00 0.00 -6.00 12.00 5.00 -5.00 0.00 -6.00 -8.00 -5.00 -3.00 -3.00 0.00 2.00 12.00 0.00 13.00 0.00 4.55 4.55 9.50 0.00 2.50 2.50 2.50 -4.00 5.00 -1.00 1.00 0.00 1.00 -1.00 0.00 2.00 0.00 4.00 0.50 -2.00 3.50 9.50 0.00 2.00 -7.00 0.00 -3.00 0.00 4.55 4.55 3.00 0.00 -5.00 15.00 10.00 -10.00 6.00 4.00 -2.00 0.00 3.00 -5.00 -4.00 6.00 0.00 1.00 6.00 0.00 2.00 2.00 0.00 -2.00 -11.00 0.00 -5.00 0.00 4.55 4.55 0.00 0.00 2.00 -2.00 -2.00 6.00 -3.00 -3.00 15.00 0.00 -2.00 8.00 6.00 -3.00 0.00 -2.00 -3.00 -3.00 -1.00 2.00 0.00 11.00 -5.00 0.00 1.00 0.00 4.55 4.55 3.00 0.00 -6.00 10.00 15.00 -6.00 5.00 4.00 -2.00 0.00 3.00 -3.00 -2.00 5.00 0.00 1.00 6.00 0.00 2.00 2.00 0.00 -2.00 -11.00 0.00 -5.00 0.00 4.55 4.55 5.00 0.00 4.00 4.00 3.50 -4.50 10.50 -2.00 -2.00 0.00 0.50 -4.50 -3.00 3.50 0.00 3.50 0.50 -1.00 10.50 3.50 0.00 0.50 -3.50 0.00 -5.00 0.00 4.55 4.55 -0.50 0.00 2.50 -4.00 -2.00 6.00 0.00 -1.50 2.50 0.00 -2.00 4.00 1.00 -1.00 0.00 -1.00 -4.50 -2.00 6.00 0.00 0.00 0.50 7.50 0.00 4.50 0.00 4.55 4.55 4.00 0.00 2.00 2.00 2.00 -3.00 4.00 -1.00 2.00 0.00 2.00 -1.00 0.00 2.00 0.00 3.00 -1.00 -1.00 3.00 15.00 0.00 2.00 -6.00 0.00 -3.00 0.00 4.55 4.55 9.50 0.00 4.50 2.50 2.50 -4.00 6.00 -1.50 -0.50 0.00 1.00 -2.50 -1.50 2.50 0.00 4.50 0.50 -1.00 9.50 3.50 0.00 0.50 -2.50 0.00 -3.50 0.00 4.55 4.55 -1.00 0.00 -8.00 -5.00 -3.00 12.00 -5.00 -2.00 8.00 0.00 -3.00 15.00 12.00 -4.00 0.00 -3.00 -1.00 -4.00 -4.00 -1.00 0.00 8.00 5.00 0.00 3.00 0.00 4.55 4.55 3.50 0.00 -4.50 -4.00 -4.00 3.50 -2.00 -1.00 -2.50 0.00 0.50 2.00 -1.50 -0.50 0.00 -1.50 -1.50 5.00 3.50 -1.00 0.00 -3.00 3.50 0.00 4.00 0.00 4.55 4.55 9.50 0.00 4.50 2.50 2.50 -4.00 6.00 -1.50 -0.50 0.00 1.00 -2.50 -1.50 2.50 0.00 4.50 0.50 -1.00 9.50 3.50 0.00 0.50 -2.50 0.00 -3.50 0.00 4.55 4.55 8.50 0.00 -1.50 4.50 4.50 -6.50 4.00 2.50 -1.50 0.00 2.00 -1.00 0.00 3.00 0.00 4.00 8.50 0.50 1.50 1.50 0.00 0.00 -6.50 0.00 -4.50 0.00 4.55 4.55 1.50 0.00 7.50 -2.50 -3.00 -0.50 1.00 -0.50 1.00 0.00 -3.00 -4.00 -3.00 -1.50 0.00 0.50 -3.00 -1.50 3.00 1.00 0.00 1.00 -6.00 0.00 5.00 0.00 4.55 4.55 1.50 0.00 0.50 3.00 3.00 -2.00 1.00 7.00 -0.50 0.00 1.50 -1.50 -1.50 3.50 0.00 2.50 2.50 2.00 0.50 7.00 0.00 -0.50 -3.50 0.00 0.00 0.00 4.55 4.55 10.00 0.00 2.00 2.00 2.00 -5.50 4.50 0.50 -1.00 0.00 0.50 -2.00 -1.00 1.00 0.00 10.00 2.50 0.00 4.00 3.50 0.00 1.50 -8.00 0.00 -5.50 0.00 4.55 4.55 2.50 0.00 -5.50 10.50 8.00 -9.00 4.00 5.00 -2.50 0.00 3.50 -3.00 -2.00 5.00 0.00 2.00 10.50 2.00 0.50 0.50 0.00 -2.00 -8.00 0.00 -5.50 0.00 4.55 4.55 1.00 0.00 -7.00 2.50 6.00 3.00 0.00 1.00 3.00 0.00 0.00 6.00 5.00 0.50 0.00 -1.00 2.50 -2.00 -1.00 0.50 0.00 3.00 -3.00 0.00 -1.00 0.00 4.55 4.55 [Part of this file has been deleted for brevity] 7.50 0.00 1.50 1.50 1.50 -2.50 3.00 -0.50 0.00 0.00 0.00 -0.50 0.00 1.00 0.00 2.50 1.00 -1.50 2.00 2.00 0.00 1.00 -4.00 0.00 -1.50 0.00 4.55 4.55 1.50 0.00 -3.00 5.00 7.50 -3.00 2.50 2.00 -1.00 0.00 1.50 -1.50 -1.00 2.50 0.00 0.50 3.00 0.00 1.00 1.00 0.00 -1.00 -5.50 0.00 -2.50 0.00 4.55 4.55 1.50 0.00 -2.50 7.50 5.00 -5.00 3.00 2.00 -1.00 0.00 1.50 -2.50 -2.00 3.00 0.00 0.50 3.00 0.00 1.00 1.00 0.00 -1.00 -5.50 0.00 -2.50 0.00 4.55 4.55 1.50 0.00 -0.50 3.00 2.50 -5.50 6.00 1.50 -3.00 0.00 3.50 -4.50 -0.50 2.50 0.00 3.00 3.00 6.00 3.50 1.50 0.00 -0.50 1.50 0.00 -6.00 0.00 4.55 4.55 0.00 0.00 -3.00 1.50 1.50 -3.00 -0.50 0.50 -1.00 0.00 7.50 -1.50 1.00 2.00 0.00 0.50 2.00 4.00 1.00 1.00 0.00 -1.00 0.50 0.00 -3.00 0.00 4.55 4.55 2.50 0.00 -5.50 10.50 8.00 -9.00 4.00 5.00 -2.50 0.00 3.50 -3.00 -2.00 5.00 0.00 2.00 10.50 2.00 0.50 0.50 0.00 -2.00 -8.00 0.00 -5.50 0.00 4.55 4.55 -1.50 0.00 6.00 -3.50 -3.50 9.50 -4.50 0.00 8.00 0.00 -4.00 5.50 2.50 -2.00 0.00 -5.00 -4.50 -4.50 -2.50 -0.50 0.00 5.00 3.00 0.00 8.00 0.00 4.55 4.55 3.00 0.00 -5.50 12.50 12.50 -8.00 5.50 4.00 -2.00 0.00 3.00 -4.00 -3.00 5.50 0.00 1.00 6.00 0.00 2.00 2.00 0.00 -2.00 -11.00 0.00 -5.00 0.00 4.55 4.55 2.00 0.00 2.00 -2.00 -2.00 2.00 2.00 -3.00 11.00 0.00 -2.00 8.00 6.00 -3.00 0.00 1.00 -2.00 -3.00 -1.00 2.00 0.00 15.00 -8.00 0.00 -1.00 0.00 4.55 4.55 3.50 0.00 -2.00 6.00 8.50 -4.50 4.50 1.50 0.00 0.00 2.50 -2.00 -1.00 3.50 0.00 2.00 2.50 -0.50 2.50 8.50 0.00 0.00 -8.50 0.00 -4.00 0.00 4.55 4.55 10.00 0.00 2.00 2.00 2.00 -5.50 4.50 0.50 -1.00 0.00 0.50 -2.00 -1.00 1.00 0.00 10.00 2.50 0.00 4.00 3.50 0.00 1.50 -8.00 0.00 -5.50 0.00 4.55 4.55 2.50 0.00 -3.00 0.50 1.00 3.00 5.00 -2.00 2.50 0.00 -2.00 5.00 4.50 0.00 0.00 0.00 0.50 -3.50 1.00 1.50 0.00 5.00 -2.50 0.00 -1.50 0.00 4.55 4.55 1.50 0.00 7.50 -2.50 -3.00 -0.50 1.00 -0.50 1.00 0.00 -3.00 -4.00 -3.00 -1.50 0.00 0.50 -3.00 -1.50 3.00 1.00 0.00 1.00 -6.00 0.00 5.00 0.00 4.55 4.55 6.00 0.00 2.00 6.00 5.00 -6.00 15.00 -2.00 -3.00 0.00 -1.00 -5.00 -3.00 4.00 0.00 3.00 2.00 -3.00 6.00 4.00 0.00 2.00 -10.00 0.00 -6.00 0.00 4.55 4.55 4.50 0.00 -1.50 10.50 7.50 -8.00 10.50 1.00 -2.50 0.00 1.00 -5.00 -3.50 5.00 0.00 2.00 4.00 -1.50 4.00 3.00 0.00 0.00 -10.50 0.00 -5.50 0.00 4.55 4.55 1.50 0.00 -3.00 5.00 7.50 -3.00 2.50 2.00 -1.00 0.00 1.50 -1.50 -1.00 2.50 0.00 0.50 3.00 0.00 1.00 1.00 0.00 -1.00 -5.50 0.00 -2.50 0.00 4.55 4.55 -0.50 0.00 -0.50 -1.00 -1.00 -1.50 -0.50 1.00 4.00 0.00 3.00 2.00 4.00 -1.00 0.00 2.00 1.00 6.00 0.00 0.50 0.00 6.00 2.50 0.00 -3.50 0.00 4.55 4.55 8.50 0.00 0.00 4.50 4.00 -5.00 5.00 2.00 -1.50 0.00 2.00 -2.50 -1.50 8.50 0.00 2.50 3.00 -1.00 3.50 3.00 0.00 -0.50 -5.50 0.00 -2.00 0.00 4.55 4.55 -0.50 0.00 -4.00 -2.50 -1.50 6.00 -2.50 -1.00 4.00 0.00 -1.50 7.50 6.00 -2.00 0.00 -1.50 -0.50 -2.00 -2.00 -0.50 0.00 4.00 2.50 0.00 1.50 0.00 4.55 4.55 6.00 0.00 0.00 1.50 1.50 -5.00 1.50 2.00 -1.50 0.00 4.00 -2.50 1.00 1.50 0.00 4.00 3.00 6.00 2.50 1.50 0.00 -0.50 2.50 0.00 -4.50 0.00 4.55 4.55 1.50 0.00 6.00 0.50 0.00 3.50 4.50 0.50 -1.00 0.00 -3.50 -1.00 -2.00 1.50 0.00 -2.50 -2.00 -4.50 1.00 0.50 0.00 0.50 0.50 0.00 4.50 0.00 4.55 4.55 -0.50 0.00 -4.00 -2.50 -1.50 6.00 -2.50 -1.00 4.00 0.00 -1.50 7.50 6.00 -2.00 0.00 -1.50 -0.50 -2.00 -2.00 -0.50 0.00 4.00 2.50 0.00 1.50 0.00 4.55 4.55 1.00 0.00 -2.00 0.50 0.50 -2.00 0.50 -1.00 4.50 0.00 6.50 2.50 4.00 0.50 0.00 1.00 1.00 2.50 0.50 2.00 0.00 6.50 -3.50 0.00 -3.50 0.00 4.55 4.55 3.50 0.00 0.00 6.00 8.50 -4.50 5.50 1.00 -1.50 0.00 2.50 -3.50 -2.50 4.00 0.00 2.50 2.50 0.50 8.50 2.50 0.00 -1.50 -4.00 0.00 -4.50 0.00 4.55 4.55 1.00 0.00 -3.00 9.50 7.00 -5.50 2.00 9.50 -2.50 0.00 2.00 -3.50 -3.50 5.50 0.00 1.50 6.00 2.50 0.00 0.50 0.00 -2.50 -6.00 0.00 -1.00 0.00 4.55 4.55 4.50 0.00 3.50 1.50 1.50 -4.50 4.50 0.00 -1.50 0.00 1.50 -3.50 -2.50 1.50 0.00 9.50 1.00 2.00 9.50 3.00 0.00 0.00 -2.50 0.00 -6.00 0.00 4.55 4.55 1.00 0.00 2.00 -2.00 -2.00 4.00 -0.50 -3.00 13.00 0.00 -2.00 8.00 6.00 -3.00 0.00 -0.50 -2.50 -3.00 -1.00 2.00 0.00 13.00 -6.50 0.00 0.00 0.00 4.55 4.55 1.50 0.00 -6.00 6.50 9.00 -6.00 2.00 2.50 -2.00 0.00 9.00 -3.00 0.00 4.50 0.00 1.00 5.00 4.00 2.00 2.00 0.00 -2.00 -5.00 0.00 -5.50 0.00 4.55 4.55 2.00 0.00 -2.00 -1.00 0.00 1.00 0.50 -2.00 4.00 0.00 2.00 5.50 7.50 -0.50 0.00 0.50 -0.50 0.50 0.00 7.50 0.00 4.00 -4.50 0.00 -2.00 0.00 4.55 4.55 -4.00 0.00 4.50 -7.50 -5.50 14.00 -6.00 1.00 3.50 0.00 -6.00 7.50 2.00 -3.00 0.00 -7.00 -7.00 -5.50 -3.50 -3.00 0.00 0.50 11.50 0.00 14.00 0.00 4.55 4.55 0.50 0.00 -7.00 0.50 1.50 2.00 -1.50 2.00 2.50 0.00 0.50 7.00 6.00 0.00 0.00 0.00 7.00 0.00 -2.50 -1.00 0.00 3.00 0.00 0.00 -1.50 0.00 4.55 4.55 -0.50 0.00 -3.00 -3.50 -2.50 9.00 -4.00 -2.50 11.50 0.00 -2.50 11.50 9.00 -3.50 0.00 -2.50 -2.00 -3.50 -2.50 0.50 0.00 9.50 0.00 0.00 2.00 0.00 4.55 4.55 0.50 0.00 -5.50 0.50 1.00 3.50 -0.50 1.50 2.50 0.00 0.50 5.50 4.50 5.50 0.00 -1.50 1.50 -1.50 -0.50 0.50 0.00 2.50 1.00 0.00 1.00 0.00 4.55 4.55 2.00 0.00 1.00 1.00 1.00 -1.50 2.00 -0.50 1.00 0.00 1.00 -0.50 0.00 1.00 0.00 1.50 -0.50 -0.50 1.50 7.50 0.00 1.00 -3.00 0.00 -1.50 0.00 4.55 4.55 1.00 0.00 1.00 -1.00 -1.00 1.00 1.00 -1.50 5.50 0.00 -1.00 4.00 3.00 -1.50 0.00 0.50 -1.00 -1.50 -0.50 1.00 0.00 7.50 -4.00 0.00 -0.50 0.00 4.55 4.55 2.50 0.00 0.50 0.50 0.50 -3.00 1.50 1.00 -1.00 0.00 0.50 -1.50 -1.00 0.00 0.00 7.50 1.50 1.50 2.00 1.50 0.00 0.50 -4.00 0.00 -4.00 0.00 4.55 4.55 2.00 0.00 3.00 1.00 1.00 -1.50 3.00 -1.00 -0.50 0.00 1.00 -2.00 -1.50 1.50 0.00 2.00 -0.50 0.50 7.50 1.50 0.00 -0.50 1.50 0.00 -2.00 0.00 4.55 4.55 -1.50 0.00 -1.50 0.00 0.00 -2.50 -1.50 2.50 -1.50 0.00 4.00 -2.00 1.00 0.50 0.00 1.50 2.00 7.50 0.50 -0.50 0.00 -1.50 6.50 0.00 -3.00 0.00 4.55 4.55 1.00 0.00 -1.50 3.00 2.50 -2.50 2.00 2.50 -1.50 0.00 2.00 -2.00 -1.50 7.50 0.00 0.00 2.00 0.50 1.50 1.00 0.00 -1.50 -1.50 0.00 -0.50 0.00 4.55 4.55 -2.50 0.00 -0.50 -5.00 -3.00 7.50 -3.00 -0.50 3.00 0.00 -3.00 6.00 2.50 -2.50 0.00 -3.00 -4.00 -2.50 -1.50 -1.50 0.00 1.00 6.00 0.00 6.50 0.00 4.55 4.55 7.50 0.00 1.50 1.50 1.50 -2.50 3.00 -0.50 0.00 0.00 0.00 -0.50 0.00 1.00 0.00 2.50 1.00 -1.50 2.00 2.00 0.00 1.00 -4.00 0.00 -1.50 0.00 4.55 4.55 7.50 0.00 1.50 1.50 1.50 -2.50 3.00 -0.50 0.00 0.00 0.00 -0.50 0.00 1.00 0.00 2.50 1.00 -1.50 2.00 2.00 0.00 1.00 -4.00 0.00 -1.50 0.00 4.55 4.55 -0.50 0.00 -4.00 -2.50 -1.50 6.00 -2.50 -1.00 4.00 0.00 -1.50 7.50 6.00 -2.00 0.00 -1.50 -0.50 -2.00 -2.00 -0.50 0.00 4.00 2.50 0.00 1.50 0.00 4.55 4.55 -1.50 0.00 -1.50 0.00 0.00 -2.50 -1.50 2.50 -1.50 0.00 4.00 -2.00 1.00 0.50 0.00 1.50 2.00 7.50 0.50 -0.50 0.00 -1.50 6.50 0.00 -3.00 0.00 4.55 4.55 -0.50 0.00 -4.00 -2.50 -1.50 6.00 -2.50 -1.00 4.00 0.00 -1.50 7.50 6.00 -2.00 0.00 -1.50 -0.50 -2.00 -2.00 -0.50 0.00 4.00 2.50 0.00 1.50 0.00 4.55 4.55 1.50 0.00 -2.50 7.50 5.00 -5.00 3.00 2.00 -1.00 0.00 1.50 -2.50 -2.00 3.00 0.00 0.50 3.00 0.00 1.00 1.00 0.00 -1.00 -5.50 0.00 -2.50 0.00 4.55 4.55 -1.50 0.00 -1.50 0.00 0.00 -2.50 -1.50 2.50 -1.50 0.00 4.00 -2.00 1.00 0.50 0.00 1.50 2.00 7.50 0.50 -0.50 0.00 -1.50 6.50 0.00 -3.00 0.00 4.55 4.55 1.50 0.00 -3.00 5.00 7.50 -3.00 2.50 2.00 -1.00 0.00 1.50 -1.50 -1.00 2.50 0.00 0.50 3.00 0.00 1.00 1.00 0.00 -1.00 -5.50 0.00 -2.50 0.00 4.55 4.55 -1.50 0.00 5.00 -2.50 -2.50 6.50 -3.00 1.50 0.50 0.00 -3.00 1.50 -0.50 -0.50 0.00 -4.00 -3.00 -3.00 -2.00 -1.50 0.00 -0.50 5.50 0.00 7.50 0.00 4.55 4.55 -2.50 0.00 -0.50 -5.00 -3.00 7.50 -3.00 -0.50 3.00 0.00 -3.00 6.00 2.50 -2.50 0.00 -3.00 -4.00 -2.50 -1.50 -1.50 0.00 1.00 6.00 0.00 6.50 0.00 4.55 4.55 1.50 0.00 -2.50 7.50 5.00 -5.00 3.00 2.00 -1.00 0.00 1.50 -2.50 -2.00 3.00 0.00 0.50 3.00 0.00 1.00 1.00 0.00 -1.00 -5.50 0.00 -2.50 0.00 4.55 4.55 |
Standard (Mandatory) qualifiers (* if not always prompted): [-dafinpath] dirlist This option specifies the location of DAF files (domain alignment files) (input). A 'domain alignment file' contains a sequence alignment of domains belonging to the same SCOP or CATH family. The file is in clustal format annotated with domain family classification information. The files generated by using SCOPALIGN will contain a structure-based sequence alignment of domains of known structure only. Such alignments can be extended with sequence relatives (of unknown structure) by using SEQALIGN. -matrixfile matrixf This option specifies the residue substitution matrix. Epprofile for Gribskov profiles or EBLOSUM62 otherwise. -mode menu This option specifies the mode of LIBGEN operation. LIBGEN generates one of six types of profile for each alignment. Supported profiles include simple frequency matrices, Gribskov profiles, Hennikoff profiles, hidden Markov models (HMMER package), hidden Markov models (SAM-T2K package) and position-specific scoring matrices. * -threshold integer This option specifies the threshold reporting percentage. The threshold reporting percentage is used in the construction of the simple frequency matrix. * -gapopen float This option specifies the gap insertion penalty. The gap insertion penalty is the score taken away when a gap is created. The best value depends on the choice of comparison matrix. The default value assumes you are using the EBLOSUM62 matrix for protein sequences, and the EDNAFULL matrix for nucleotide sequences. * -gapextend float This option specifies the gap extension penalty. The gap extension, penalty is added to the standard gap penalty for each base or residue in the gap. This is how long gaps are penalized. Usually you will expect a few long gaps rather than many short gaps, so the gap extension penalty should be lower than the gap penalty. [-outdir] outdir This option specifies the location of discriminator files (output). The discriminator files contain one of the supported profiles, including simple frequency matrices, Gribskov profiles, Hennikoff profiles, hidden Markov models (HMMER package), hidden Markov models (SAM-T2K package) and position-specific scoring matrices. Additional (Optional) qualifiers: (none) Advanced (Unprompted) qualifiers: (none) Associated qualifiers: (none) General qualifiers: -auto boolean Turn off prompts -stdout boolean Write standard output -filter boolean Read standard input, write standard output -options boolean Prompt for standard and additional values -debug boolean Write debug output to program.dbg -verbose boolean Report some/full command line options -help boolean Report command line options. More information on associated and general qualifiers can be found with -help -verbose -warning boolean Report warnings -error boolean Report errors -fatal boolean Report fatal errors -die boolean Report deaths
Standard (Mandatory) qualifiers | Allowed values | Default | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
[-dafinpath] (Parameter 1) |
This option specifies the location of DAF files (domain alignment files) (input). A 'domain alignment file' contains a sequence alignment of domains belonging to the same SCOP or CATH family. The file is in clustal format annotated with domain family classification information. The files generated by using SCOPALIGN will contain a structure-based sequence alignment of domains of known structure only. Such alignments can be extended with sequence relatives (of unknown structure) by using SEQALIGN. | Directory with files | ./ | ||||||||||||
-matrixfile | This option specifies the residue substitution matrix. Epprofile for Gribskov profiles or EBLOSUM62 otherwise. | Comparison matrix file in EMBOSS data path | Epprofile for Gribskov type, or EBLOSUM62 | ||||||||||||
-mode | This option specifies the mode of LIBGEN operation. LIBGEN generates one of six types of profile for each alignment. Supported profiles include simple frequency matrices, Gribskov profiles, Hennikoff profiles, hidden Markov models (HMMER package), hidden Markov models (SAM-T2K package) and position-specific scoring matrices. |
|
1 | ||||||||||||
-threshold | This option specifies the threshold reporting percentage. The threshold reporting percentage is used in the construction of the simple frequency matrix. | Integer from 1 to 100 | 75 | ||||||||||||
-gapopen | This option specifies the gap insertion penalty. The gap insertion penalty is the score taken away when a gap is created. The best value depends on the choice of comparison matrix. The default value assumes you are using the EBLOSUM62 matrix for protein sequences, and the EDNAFULL matrix for nucleotide sequences. | Any numeric value | 3.0 | ||||||||||||
-gapextend | This option specifies the gap extension penalty. The gap extension, penalty is added to the standard gap penalty for each base or residue in the gap. This is how long gaps are penalized. Usually you will expect a few long gaps rather than many short gaps, so the gap extension penalty should be lower than the gap penalty. | Any numeric value | 0.3 | ||||||||||||
[-outdir] (Parameter 2) |
This option specifies the location of discriminator files (output). The discriminator files contain one of the supported profiles, including simple frequency matrices, Gribskov profiles, Hennikoff profiles, hidden Markov models (HMMER package), hidden Markov models (SAM-T2K package) and position-specific scoring matrices. | Output directory | ./ | ||||||||||||
Additional (Optional) qualifiers | Allowed values | Default | |||||||||||||
(none) | |||||||||||||||
Advanced (Unprompted) qualifiers | Allowed values | Default | |||||||||||||
(none) |
% libgen Generate discriminating elements from alignments. Location of DAF files (domain alignment files) (input). [./]: ../domainalign-keep/daf Residue substitution matrix. [EBLOSUM62]: EBLOSUM62 Discrimininator type 1 : Simple frequency matrix 2 : Gribskov profile 3 : Henikoff profile 4 : Hidden Markov model (HMMER) 5 : Hidden Markov model (SAM-T2K) 6 : Position-specific scoring matrix Select type. [1]: 2 Location of discriminator files (output). [./]: |
Go to the output files for this example
FILE TYPE | FORMAT | DESCRIPTION | CREATED BY | SEE ALSO |
Domain alignment file | DAF format (CLUSTAL-like format with domain classification information). | Contains a sequence alignment of domains belonging to the same SCOP or CATH family. The file is annotated with domain family classification information. | DOMAINALIGN (structure-based sequence alignment of domains of known structure). | DOMAINALIGN alignments can be extended with sequence relatives (of unknown structure) to the family in question by using SEQALIGN. |
Hidden Markov models | A file containing a hidden Markov model. | Can be generated for SCOP or CATH families by using LIBGEN which uses the HMMER & SAM-T2K packages. | N.A. | |
Simple frequency matrices, Gribskov profiles, Hennikoff profiles & position-specific scoring matrices | A file containing a simple frequency matrix, Gribskov profile, Hennikoff profile or position-specific scoring matrix. | Can be generated for SCOP or CATH families by using LIBGEN, which uses the BLAST package. | N.A. |
Program name | Description |
---|---|
contactcount | Count specific versus non-specific contacts |
contacts | Generate intra-chain CON files from CCF files |
domainalign | Generate alignments (DAF file) for nodes in a DCF file |
domainrep | Reorder DCF file to identify representative structures |
domainreso | Remove low resolution domains from a DCF file |
interface | Generate inter-chain CON files from CCF files |
matgen3d | Generate a 3D-1D scoring matrix from CCF files |
psiphi | Phi and psi torsion angles from protein coordinates |
rocon | Generates a hits file from comparing two DHF files |
rocplot | Performs ROC analysis on hits files |
scorecmapdir | Contact scores for cleaned protein chain contact files |
seqalign | Extend alignments (DAF file) with sequences (DHF file) |
seqfraggle | Removes fragment sequences from DHF files |
seqsearch | Generate PSI-BLAST hits (DHF file) from a DAF file |
seqsort | Remove ambiguous classified sequences from DHF files |
seqwords | Generates DHF files from keyword search of UniProt |
siggen | Generates a sparse protein signature from an alignment |
siggenlig | Generate ligand-binding signatures from a CON file |
sigscan | Generate hits (DHF file) from a signature search |
sigscanlig | Search ligand-signature library & write hits (LHF file) |
See also http://emboss.sourceforge.net/